HORDB

ID: hor005764
Uniprot ID: P01156
Protein name: Tail peptide
Gene name: NTS
Organism: Bos taurus (Bovine)
Family: Neurotensin family
Source: animal
Expression: Brain and gut.
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0010628 positive regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle; GO:0043231 intracellular membrane-bounded organelle; GO:0043679 axon terminus

Sequence: GSYYY
Length: 5
Propeptide: MMAGMKIQLVCMILLAFSSWSLCSDSEEEMKALETDLLTNMHTSKISKASVPSWKMSLLNVCSLINNLNSQAEETGEFHEEELITRRKFPAALDGFSLEAMLTIYQLQKICHSRAFQHWELIQEDILDAGNDKNEKEEVIKRKIPYILKRQLYENKPRRPYILKRGSYYY
Signal peptide: MMAGMKIQLVCMILLAFSSWSLC
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Mechanism: NA
Cross BBB: NA
Target: NTSR1
Target Unid: F1MWG2
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005764_AF2.pdb

hor005764_ESM.pdb

Mass:	72319	Formula:	C32H37N5O10
Absent amino acids:	ACDEFHIKLMNPQRTVW	Common amino acids:	Y
pI:	6.08	Basic residues:	0
Polar residues:	5	Hydrophobic residues:	0
Hydrophobicity:	-102	Boman Index:	-288
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	5736	Extinction Coefficient cystines:	4470
Absorbance 280nm:	1117.5

PubMed ID: 2832414
Title: The rat gene encoding neurotensin and neuromedin N. Structure, tissue-specific expression, and evolution of exon sequences.
PubMed ID: 1167549
Title: The amino acid sequence of a hypothalamic peptide, neurotensin.
PubMed ID: 1112838
Title: The synthesis of neurotensin.